PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589181.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 494aa    MW: 54866.7 Da    PI: 6.6213
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589181.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK57.23.3e-18305350348
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                       i+le+l+++F ++++dAA++Lgv  ++LKriCR y I RWP+ k
  XP_009589181.1 305 YGITLEVLKQHFGKKLTDAANSLGVARSTLKRICRDYEIYRWPRVK 350
                     579****************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.174288378IPR003035RWP-RK domain
PfamPF020422.2E-16307352IPR003035RWP-RK domain
SuperFamilySSF542775.61E-17399485No hitNo description
Gene3DG3DSA:3.10.20.2405.7E-15406485No hitNo description
PROSITE profilePS5174516.169407488IPR000270PB1 domain
SMARTSM006662.7E-14407488IPR000270PB1 domain
PfamPF005641.1E-14408486IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MDNPNNIELE GGKFLLKLIQ ESKDEPTKMA TKLYVILQHM RSSGKEDSMP FKVIARAMET  60
IVKQHGLDIE ALTSSRHPVT VGAQVGEVAL SQVAGSLQRV EVTRNMTVNF LGNEMVKADV  120
YASNGAVSGS SGSGHGIYRA SGIHISGHPR SATEATQDRG DAMQSGILFD MPNSFEIGQY  180
QPAAVATLDN GDTMQLDAFF DVRDFIEFGQ PLSATKDKGD ANLVDSNQTT TTGIADNRRH  240
SPTLDDDVAR SPPGLELGIG TQIVQLGSEH HQVDDVEVDA RDLQRNVVHA DLEKQNKTKR  300
IKREYGITLE VLKQHFGKKL TDAANSLGVA RSTLKRICRD YEIYRWPRVK SRKHNCSLSQ  360
EELLQVDRQP SDSGVRHQQY VDFSPRSGPK SATNSKELHV TMQSENFISV KVTYGNRTVR  420
FPLSFSSGKR DLEEEVEKRI KLVGNSSIRY EDEEKDLILI TCDSDLHYAM HTLRSLGRTI  480
IKMLVEIEPG TTIT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589178.10.0PREDICTED: uncharacterized protein LOC104086579
RefseqXP_009589179.10.0PREDICTED: uncharacterized protein LOC104086579
RefseqXP_009589180.10.0PREDICTED: uncharacterized protein LOC104086579
RefseqXP_009589181.10.0PREDICTED: uncharacterized protein LOC104086579
RefseqXP_009589182.10.0PREDICTED: uncharacterized protein LOC104086579
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.15e-15Nin-like family protein